HPA021823

HS3ST5 antibody from Atlas Antibodies
3-OST-5
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA021823
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA021823, RRID:AB_1851100
Product name
Anti-HS3ST5
Provider product page
Atlas Antibodies - HPA021823
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLH
EFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTR
ALLEMLNLHPAVVKASQEIHF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -