HPA021823

HS3ST5 antibody from Sigma-Aldrich
3-OST-5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021823
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021823, RRID:AB_1851100
Product name
Anti-HS3ST5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021823
Antibody type
Polyclonal
Antigen
Heparan sulfate glucosamine 3-O-sulfotransferase 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DRLQPICPIEGRLGGARTQAEFPLRALQFKRGLLH
EFRKGNASKEQVRLHDLVQQLPKAIIIGVRKGGTR
ALLEMLNLHPAVVKASQEIHF
Storage
-20C
Provider Type Product Number
- No reagents -