HPA006035

ACTN1 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA006035
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA006035, RRID:AB_1078095
Product name
Anti-ACTN1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA006035
Antibody type
Polyclonal
Antigen
alpha-Actinin-1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGF
CALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEK
YLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAF
SGAQKAETAANRICKV
Storage
-20C
Provider Type Product Number
- No reagents -