Antibody data
- Antibody Data
 - Antigen structure
 - References [0]
 - Comments [0]
 - Validations
 - Western blot [1]
 - ELISA [1]
 - Immunohistochemistry [1]
 
Submit
Validation data
Reference
Comment
Report error
- Product number
 - H00050945-M01 - Provider product page

 - Provider
 - Abnova Corporation
 - Proper citation
 - Abnova Corporation Cat#H00050945-M01, RRID:AB_1137489
 - Product name
 - TBX22 monoclonal antibody (M01), clone 1A10
 - Antibody type
 - Monoclonal
 - Description
 - Mouse monoclonal antibody raised against a partial recombinant TBX22.
 - Antigen sequence
 DQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALS
CSFHPSYDFYRYNFSMPSRLISGSNHLKVNDDSQV
SFGEGKCNHVHWYPAINHY- Isotype
 - IgG
 - Antibody clone number
 - 1A10
 - Storage
 - Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
 
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Western Blot analysis of TBX22 expression in transfected 293T cell line by TBX22 monoclonal antibody (M01), clone 1A10.Lane 1: TBX22 transfected lysate (Predicted MW: 57.9 KDa).Lane 2: Non-transfected lysate.
 
							
					Supportive validation
					
									
				
				- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Detection limit for recombinant GST tagged TBX22 is 0.3 ng/ml as a capture antibody.
 - Validation comment
 - Sandwich ELISA (Recombinant protein)
 - Protocol
 - Protocol
 
							
					Supportive validation
					
									
				
		- Submitted by
 - Abnova Corporation (provider)
 - Main image
 
- Experimental details
 - Immunoperoxidase of monoclonal antibody to TBX22 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1.5 ug/ml]
 - Validation comment
 - Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
 - Protocol
 - Protocol