HPA003105

TBX22 antibody from Sigma-Aldrich
CLPA, CPX
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003105
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003105, RRID:AB_1080225
Product name
Anti-TBX22 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003105
Antibody type
Polyclonal
Antigen
T-box transcription factor TBX22 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PLNSLLSPLCFSPMFHLPTSSLGMPCPEAYLPNVN
LPLCYKICPTNFWQQQPLVLPAPERLASSNSSQSL
APLMMEVPMLSSLGVTNSKSGSSEDSSDQYLQAPN
STNQMLYGLQSPGNIFLPNSITPEAL
Storage
-20C
Provider Type Product Number
- No reagents -