WH0057509M1

MTUS1 antibody from Sigma-Aldrich
ATBP, ATIP1, ATIP3, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1
ELISA
Recommended by provider

Antibody data

Product number
WH0057509M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0057509M1, RRID:AB_1842555
Product name
Monoclonal Anti-MTUS1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0057509M1
Antibody type
Monoclonal
Antigen
MTUS1 (AAH33842, a.a. 1-241) full length recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
MQLQEQFDNLNAAHETSKLEIEASHSEKLELLTKA
YEASLSEIKKGHEIEKKSLEDLLSEKQESLEKQIN
DLKSENDALNEKLKSEEQKRRAREKANLKNPQIMY
LEQELESLKAVLEIKNEKLHQQDIKLMKMEKLVDN
NTALVDKLKRFQQENEELKARMDKHMAISRQLSTE
QAVLQESLEKESKVNKRLSMENEELLWKLHNGDLC
SPKRSPTSSAIPLQSPRNSGSFPSPSISPR* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -