H00057509-M01
antibody from Abnova Corporation
		Targeting: MTUS1
		
		ATBP, ATIP1, ATIP3, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1	
	
	
	
	
Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057509-M01 - Provider product page 
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057509-M01, RRID:AB_464093
- Product name
- MTUS1 monoclonal antibody (M01), clone 1C7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant MTUS1.
- Antigen sequence
- MQLQEQFDNLNAAHETSKLEIEASHSEKLELLTKA
 YEASLSEIKKGHEIEKKSLEDLLSEKQESLEKQIN
 DLKSENDALNEKLKSEEQKRRAREKANLKNPQIMY
 LEQELESLKAVLEIKNEKLHQQDIKLMKMGKLVDN
 NTALVDKLKRFQQENEELKARMDKHMAISRQLSTE
 QAVLQESLEKESKVNKRLSMENEELLWKLHNGDLC
 SPKRSPTSSAIPLQSPRNSGSFPSPSISPR
- Isotype
- IgG
- Antibody clone number
- 1C7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references		Genetic and functional characterization of clonally derived adult human brown adipocytes.
				
Loss of MTUS1/ATIP expression is associated with adverse outcome in advanced bladder carcinomas: data from a retrospective study.
				
Expression and role of the angiotensin II AT2 receptor in human prostate tissue: in search of a new therapeutic option for prostate cancer.
				
Down-regulation of tumor suppressor MTUS1/ATIP is associated with enhanced proliferation, poor differentiation and poor prognosis in oral tongue squamous cell carcinoma.
				
LOH and copy neutral LOH (cnLOH) act as alternative mechanism in sporadic colorectal cancers with chromosomal and microsatellite instability.
				
8p22 MTUS1 gene product ATIP3 is a novel anti-mitotic protein underexpressed in invasive breast carcinoma of poor prognosis.
				
		
	
			Shinoda K, Luijten IH, Hasegawa Y, Hong H, Sonne SB, Kim M, Xue R, Chondronikola M, Cypess AM, Tseng YH, Nedergaard J, Sidossis LS, Kajimura S
Nature medicine 2015 Apr;21(4):389-94
		Nature medicine 2015 Apr;21(4):389-94
Loss of MTUS1/ATIP expression is associated with adverse outcome in advanced bladder carcinomas: data from a retrospective study.
			Rogler A, Hoja S, Giedl J, Ekici AB, Wach S, Taubert H, Goebell PJ, Wullich B, Stöckle M, Lehmann J, Petsch S, Hartmann A, Stoehr R
BMC cancer 2014 Mar 20;14:214
		BMC cancer 2014 Mar 20;14:214
Expression and role of the angiotensin II AT2 receptor in human prostate tissue: in search of a new therapeutic option for prostate cancer.
			Guimond MO, Battista MC, Nikjouitavabi F, Carmel M, Barres V, Doueik AA, Fazli L, Gleave M, Sabbagh R, Gallo-Payet N
The Prostate 2013 Jul;73(10):1057-68
		The Prostate 2013 Jul;73(10):1057-68
Down-regulation of tumor suppressor MTUS1/ATIP is associated with enhanced proliferation, poor differentiation and poor prognosis in oral tongue squamous cell carcinoma.
			Ding X, Zhang N, Cai Y, Li S, Zheng C, Jin Y, Yu T, Wang A, Zhou X
Molecular oncology 2012 Feb;6(1):73-80
		Molecular oncology 2012 Feb;6(1):73-80
LOH and copy neutral LOH (cnLOH) act as alternative mechanism in sporadic colorectal cancers with chromosomal and microsatellite instability.
			Melcher R, Hartmann E, Zopf W, Herterich S, Wilke P, Müller L, Rosler E, Kudlich T, Al-Taie O, Rosenwald A, Katzenberger T, Scholtka B, Seibold S, Rogoll D, Scheppach W, Scheurlen M, Lührs H
Carcinogenesis 2011 Apr;32(4):636-42
		Carcinogenesis 2011 Apr;32(4):636-42
8p22 MTUS1 gene product ATIP3 is a novel anti-mitotic protein underexpressed in invasive breast carcinoma of poor prognosis.
			Rodrigues-Ferreira S, Di Tommaso A, Dimitrov A, Cazaubon S, Gruel N, Colasson H, Nicolas A, Chaverot N, Molinié V, Reyal F, Sigal-Zafrani B, Terris B, Delattre O, Radvanyi F, Perez F, Vincent-Salomon A, Nahmias C
PloS one 2009 Oct 1;4(10):e7239
		PloS one 2009 Oct 1;4(10):e7239
				No comments: Submit comment	
	
			
							
					Supportive validation
					
									
				
				- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- MTUS1 monoclonal antibody (M01), clone 1C7. Western Blot analysis of MTUS1 expression in human ovarian cancer.
							
					Supportive validation
					
									
				
		- Submitted by
- Abnova Corporation (provider)
- Main image
 
- Experimental details
- Detection limit for recombinant GST tagged MTUS1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol