H00057509-M02A

MTUS1 antibody from Abnova Corporation
ATBP, ATIP1, ATIP3, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1
No application information provided.

Antibody data

Product number
H00057509-M02A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057509-M02A, RRID:AB_1136964
Product name
MTUS1 monoclonal antibody (M02A), clone 1C10
Provider product page
Abnova Corporation - H00057509-M02A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant MTUS1.
Antigen sequence
MQLQEQFDNLNAAHETSKLEIEASHSEKLELLTKA
YEASLSEIKKGHEIEKKSLEDLLSEKQESLEKQIN
DLKSENDALNEKLKSEEQKRRAREKANLKNPQIMY
LEQELESLKAVLEIKNEKLHQQDIKLMKMGKLVDN
NTALVDKLKRFQQENEELKARMDKHMAISRQLSTE
QAVLQESLEKESKVNKRLSMENEELLWKLHNGDLC
SPKRSPTSSAIPLQSPRNSGSFPSPSISPR
Isotype
IgM
Antibody clone number
1C10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -