HPA069795

MTUS1 antibody from Atlas Antibodies
ATBP, ATIP1, ATIP3, DKFZp586D1519, FLJ14295, ICIS, KIAA1288, MP44, MTSG1

Antibody data

Product number
HPA069795
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA069795, RRID:AB_2686198
Product name
Anti-MTUS1
Provider product page
Atlas Antibodies - HPA069795
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGKVTSEYTDGSQQRLVGEKETQALTPVSDGMEVP
NDSALQEFFCLSHDESNSEPHSQSSYRHKEMGQNL
RETVSYCLIDDECPLMVPAFDKSEAQVLN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -