PAB28736

ACTRT1 antibody from Abnova Corporation
AIP1, ARIP1, Arp-T1, KIAA0705

Antibody data

Product number
PAB28736
Provider
Abnova Corporation
Product name
ACTRT1 polyclonal antibody
Provider product page
Abnova Corporation - PAB28736
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ACTRT1.
Antigen sequence
FDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPL
ARLNQKYFVGQEALYKYEALHLHYPIERGLVTGWD
DMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREI
REKLAEMMFETFSVPGFYLSNHAVAALYASACVTG
LV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -