HPA003119

ACTRT1 antibody from Atlas Antibodies
AIP1, ARIP1, Arp-T1, KIAA0705
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003119
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003119, RRID:AB_1078219
Product name
Anti-ACTRT1
Provider product page
Atlas Antibodies - HPA003119
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPL
ARLNQKYFVGQEALYKYEALHLHYPIERGLVTGWD
DMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREI
REKLAEMMFETFSVPGFYLSNHAVAALYASACVTG
LV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -