HPA003119

ACTRT1 antibody from Sigma-Aldrich
AIP1, ARIP1, Arp-T1, KIAA0705
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003119
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003119, RRID:AB_1078219
Product name
Anti-ACTRT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003119
Antibody type
Polyclonal
Antigen
Actin-related protein T1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FDNGSGLCKAGLSGEIGPRHVISSVLGHCKFNVPL
ARLNQKYFVGQEALYKYEALHLHYPIERGLVTGWD
DMEKLWKHLFERELGVKPSQQPVLMTEPSLNPREI
REKLAEMMFETFSVPGFYLSNHAVAALYASACVTG
LV
Storage
-20C
Provider Type Product Number
- No reagents -