HPA001231

LYN antibody from Sigma-Aldrich
JTK8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001231
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001231, RRID:AB_1079286
Product name
Anti-LYN antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001231
Antibody type
Polyclonal
Antigen
Tyrosine-protein kinase Lyn recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQ
QRPVPESQLLPGQRFQTKDPEEQGDIVVALYPYDG
IHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEG
FIPSNYVAKLNTLETEEWFFKDITRKDAERQLLAP
G
Storage
-20C
Provider Type Product Number
- No reagents -