HPA003093

FAM199X antibody from Atlas Antibodies
CXorf39
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA003093
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA003093, RRID:AB_1078597
Product name
Anti-FAM199X
Provider product page
Atlas Antibodies - HPA003093
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WSAMTNDEQVEYIEYLSRKVSTEMGLREQLDIIKI
IDPSAQISPTDSEFIIELNCLTDEKLKQVRNYIKE
HSPRQRPAREAWKRSNFSCASTSGVSGASASASSS
SASMVSSASSSGSSVGNSASNSSA
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -