HPA003093

FAM199X antibody from Sigma-Aldrich
CXorf39
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003093
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003093, RRID:AB_1078597
Product name
Anti-CXorf39 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003093
Antibody type
Polyclonal
Antigen
Uncharacterized protein CXorf39 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WSAMTNDEQVEYIEYLSRKVSTEMGLREQLDIIKI
IDPSAQISPTDSEFIIELNCLTDEKLKQVRNYIKE
HSPRQRPAREAWKRSNFSCASTSGVSGASASASSS
SASMVSSASSSGSSVGNSASNSSA
Storage
-20C
Provider Type Product Number
- No reagents -