Antibody data

Product number
PAB27514
Provider
Abnova Corporation
Product name
MT1E polyclonal antibody
Provider product page
Abnova Corporation - PAB27514
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human MT1E.
Reactivity
Human
Host
Rabbit
Antigen sequence
TSCKKSECGAISRNLGLWLRLGGNSRLALSASFWG
TGLSLPSLPVSFPLQAFCPKFRWGRTAFFSWDTNP
NCTPYGFRTELCQTKKSILWVWV
Isotype
IgG
Vial size
100 μl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -