HPA019362

SPESP1 antibody from Sigma-Aldrich
SP-ESP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019362
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019362, RRID:AB_1854575
Product name
Anti-NOX5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019362
Antibody type
Polyclonal
Antigen
NADPH oxidase 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VCIMEVNLLPSKVTHLLIKRPPFFHYRPGDYLYLN
IPTIARYEWHPFTISSAPEQKDTIWLHIRSQGQWT
NRLYESFKASDPLGRGSKRLSRSVTMRKSQRSSKG
SEILLEKH
Storage
-20C
Provider Type Product Number
- No reagents -