HPA003094

RAB9A antibody from Sigma-Aldrich
RAB9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003094
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003094, RRID:AB_1079736
Product name
Anti-RAB9A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003094
Antibody type
Polyclonal
Antigen
Ras-related protein Rab-9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEP
ESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYP
YFETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQ
TDTVNLHRKP
Storage
-20C
Provider Type Product Number
- No reagents -