HPA027497

EPHA10 antibody from MilliporeSigma / Merck KGaA
FLJ16103, FLJ33655
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027497
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA027497, RRID:AB_10601158
Product name
Anti-RP4-783C10.1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA027497
Antibody type
Polyclonal
Antigen
Ephrin type-A receptor 10 Precursor (EC 2.7.10.1) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TTYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSW
REPIPAGAPGANDTEYEIRYYEKGQSEQTYSMVKT
GAPTVTVTNLKPATRYVFQIRAAS
Storage
-20C
Provider Type Product Number
- No reagents -