HPA038382

ARHGAP32 antibody from Atlas Antibodies
GC-GAP, GRIT, KIAA0712, MGC1892, RICS

Antibody data

Product number
HPA038382
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA038382, RRID:AB_2675984
Product name
Anti-ARHGAP32
Provider product page
Atlas Antibodies - HPA038382
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AVATTEDNLSSSYSAVALDKAYFQTDRPAEQFHLQ
NNAPGNCDHPLPETTATGDPTHSNTTESGEQHHQV
DLTGNQPHQAYLSGDPEKARITSVP
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.