PAB23276

ARHGAP32 antibody from Abnova Corporation
GC-GAP, GRIT, KIAA0712, MGC1892, RICS

Antibody data

Product number
PAB23276
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB23276, RRID:AB_11121433
Product name
RICS polyclonal antibody
Provider product page
Abnova Corporation - PAB23276
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant RICS.
Antigen sequence
ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSL
PQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQ
GAFLPAELSLQHPETQIHAE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.