Explore
Validate
Learn
ImmunohistochemistryAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA036230 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-DSPP
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
DSSIGQNSDSKEYYDPEGKEDPHNEVDGDKTSKSE
ENSAGIPEDNGSQRIEDTQKLNHRESKRVENRITK
ESETHAVGKSQDKGIEIKGPSSGNRN- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references piggyBac Transposon-Based Immortalization of Human Deciduous Tooth Dental Pulp Cells with Multipotency and Non-Tumorigenic Potential
CD146 positive human dental pulp stem cells promote regeneration of dentin/pulp-like structures
Human Dental Pulp Cells Differentiate toward Neuronal Cells and Promote Neuroregeneration in Adult Organotypic Hippocampal Slices In Vitro
Inada E, Saitoh I, Kubota N, Iwase Y, Kiyokawa Y, Shibasaki S, Noguchi H, Yamasaki Y, Sato M
International Journal of Molecular Sciences 2019;20(19):4904
International Journal of Molecular Sciences 2019;20(19):4904
CD146 positive human dental pulp stem cells promote regeneration of dentin/pulp-like structures
Matsui M, Kobayashi T, Tsutsui T
Human Cell 2018;31(2):127-138
Human Cell 2018;31(2):127-138
Human Dental Pulp Cells Differentiate toward Neuronal Cells and Promote Neuroregeneration in Adult Organotypic Hippocampal Slices In Vitro
Xiao L, Ide R, Saiki C, Kumazawa Y, Okamura H
International Journal of Molecular Sciences 2017;18(8):1745
International Journal of Molecular Sciences 2017;18(8):1745
No comments: Submit comment
No validations: Submit validation data