Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502477 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 5 (Iodide Transporter), Member 8 (SLC5A8) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC5A8 antibody: synthetic peptide directed towards the middle region of human SLC5A8
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPP
LPERT LPLHLDIQGC- Vial size
- 50 µg
Submitted references Molecular mechanism of SLC5A8 inactivation in breast cancer.
Role of SLC5A8, a plasma membrane transporter and a tumor suppressor, in the antitumor activity of dichloroacetate.
Activin A induces SLC5A8 expression through the Smad3 signaling pathway in human colon cancer RKO cells.
Elangovan S, Pathania R, Ramachandran S, Ananth S, Padia RN, Srinivas SR, Babu E, Hawthorn L, Schoenlein PV, Boettger T, Smith SB, Prasad PD, Ganapathy V, Thangaraju M
Molecular and cellular biology 2013 Oct;33(19):3920-35
Molecular and cellular biology 2013 Oct;33(19):3920-35
Role of SLC5A8, a plasma membrane transporter and a tumor suppressor, in the antitumor activity of dichloroacetate.
Babu E, Ramachandran S, CoothanKandaswamy V, Elangovan S, Prasad PD, Ganapathy V, Thangaraju M
Oncogene 2011 Sep 22;30(38):4026-37
Oncogene 2011 Sep 22;30(38):4026-37
Activin A induces SLC5A8 expression through the Smad3 signaling pathway in human colon cancer RKO cells.
Zhang Y, Bao YL, Yang MT, Wu Y, Yu CL, Huang YX, Sun Y, Zheng LH, Li YX
The international journal of biochemistry & cell biology 2010 Dec;42(12):1964-72
The international journal of biochemistry & cell biology 2010 Dec;42(12):1964-72
No comments: Submit comment
No validations: Submit validation data