HPA003095

NDP antibody from Sigma-Aldrich
EVR2, norrin
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003095
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003095, RRID:AB_1079457
Product name
Anti-NDP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003095
Antibody type
Polyclonal
Antigen
Norrin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TDSSFIMDSDPRRCMRHHYVDSISHPLYKCSSKMV
LLARCEGHCSQASRSEPLVSFSTVLKQPFRSSCHC
CRPQTSKLKALRLRCSGGMRLTATYRYILSCHCEE
CNS
Storage
-20C
Provider Type Product Number
- No reagents -