HPA043257

antibody from Atlas Antibodies

Targeting: WDR54 FLJ12953

Antibody data

Submit

Validation data

Product number: HPA043257 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA043257, RRID:AB_10795981
Product name: Anti-WDR54
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: RVLVFDIPAKGPNIVLSEELAGHQMPITDIATEPA QGQDCVADMVTADDSGLLCVWRSGPEFTLLTRIPG FGVPCPS
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

WDR54 protein structure - HPA043257 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human fallopian tube and liver tissues using Anti-WDR54 antibody. Corresponding WDR54 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Independent antibody validation
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex, fallopian tube, kidney and liver using Anti-WDR54 antibody HPA043257 (A) shows similar protein distribution across tissues to independent antibody HPA053558 (B).
Antibody #2 product nr: HPA053558
Antibody provider: Atlas Antibodies

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human fallopian tube shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human liver shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human kidney using Anti-WDR54 antibody HPA043257.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cerebral cortex using Anti-WDR54 antibody HPA043257.
Sample type: HUMAN