H00009459-M02
antibody from Abnova Corporation
Targeting: ARHGEF6
alpha-PIX, alphaPIX, Cool-2, Cool2, KIAA0006, MRX46, αPix
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
- Proximity ligation assay [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009459-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009459-M02, RRID:AB_1137092
- Product name
- ARHGEF6 monoclonal antibody (M02), clone 2E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ARHGEF6.
- Antigen sequence
QTEADCINNINDFLKGCATLQVEIFDPDDLYSGVN
FSKVLSTLLAVNKATEDQLSERPCGRSSSLSAANT
SQTNPQGAVSSTVSGLQRQSKTVEMTENGSHQLIV
KARFNFKQTN- Isotype
- IgG
- Antibody clone number
- 2E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ARHGEF6 expression in transfected 293T cell line by ARHGEF6 monoclonal antibody (M02), clone 2E5.Lane 1: ARHGEF6 transfected lysate (Predicted MW: 87.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ARHGEF6 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of ARHGEF6 transfected lysate using anti-ARHGEF6 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with ARHGEF6 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Proximity Ligation Analysis of protein-protein interactions between CDC42 and ARHGEF6. HeLa cells were stained with anti-CDC42 rabbit purified polyclonal 1:1200 and anti-ARHGEF6 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
- Validation comment
- In situ Proximity Ligation Assay (Cell)