Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA041259 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-TM4SF5
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
GLRNGPRCLMNGEWGYHFEDTAGAYLLNRTLWDRC
EAPPRVVPWNVTL- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Clinicopathological significance of TM4SF5 expression in human hepatocellular carcinoma tissues
Anti-cancer Activity of Novel TM4SF5-Targeting Antibodies through TM4SF5 Neutralization and Immune Cell-Mediated Cytotoxicity
Xu B, Lv W, Li X, Zhang L, Lin J
Oncology Letters 2019
Oncology Letters 2019
Anti-cancer Activity of Novel TM4SF5-Targeting Antibodies through TM4SF5 Neutralization and Immune Cell-Mediated Cytotoxicity
Ahn H, Ryu J, Song J, Lee Y, Kim H, Ko D, Choi I, Kim S, Lee J, Kim S
Theranostics 2017;7(3):594-613
Theranostics 2017;7(3):594-613
No comments: Submit comment
No validations: Submit validation data