Antibody data
- Antibody Data
- Antigen structure
- References [4]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [12]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023370 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023370, RRID:AB_1855072
- Product name
- Anti-PCM1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EEEGVSGASLSSHRSSLVDEHPEDAEFEQKINRLM
AAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDD
FYPAEEDTKQNSNNTRGNANKTQKDT- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Cardiac Myocyte De Novo DNA Methyltransferases 3a/3b Are Dispensable for Cardiac Function and Remodeling after Chronic Pressure Overload in Mice.
Epicardial FSTL1 reconstitution regenerates the adult mammalian heart.
RBM14 prevents assembly of centriolar protein complexes and maintains mitotic spindle integrity.
Dynamic DNA methylation orchestrates cardiomyocyte development, maturation and disease.
Nührenberg TG, Hammann N, Schnick T, Preißl S, Witten A, Stoll M, Gilsbach R, Neumann FJ, Hein L
PloS one 2015;10(6):e0131019
PloS one 2015;10(6):e0131019
Epicardial FSTL1 reconstitution regenerates the adult mammalian heart.
Wei K, Serpooshan V, Hurtado C, Diez-Cuñado M, Zhao M, Maruyama S, Zhu W, Fajardo G, Noseda M, Nakamura K, Tian X, Liu Q, Wang A, Matsuura Y, Bushway P, Cai W, Savchenko A, Mahmoudi M, Schneider MD, van den Hoff MJ, Butte MJ, Yang PC, Walsh K, Zhou B, Bernstein D, Mercola M, Ruiz-Lozano P
Nature 2015 Sep 24;525(7570):479-85
Nature 2015 Sep 24;525(7570):479-85
RBM14 prevents assembly of centriolar protein complexes and maintains mitotic spindle integrity.
Shiratsuchi G, Takaoka K, Ashikawa T, Hamada H, Kitagawa D
The EMBO journal 2015 Jan 2;34(1):97-114
The EMBO journal 2015 Jan 2;34(1):97-114
Dynamic DNA methylation orchestrates cardiomyocyte development, maturation and disease.
Gilsbach R, Preissl S, Grüning BA, Schnick T, Burger L, Benes V, Würch A, Bönisch U, Günther S, Backofen R, Fleischmann BK, Schübeler D, Hein L
Nature communications 2014 Oct 22;5:5288
Nature communications 2014 Oct 22;5:5288
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
- Sample type
- HUMAN
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human kidney, liver, ovary and testis using Anti-PCM1 antibody HPA023370 (A) shows similar protein distribution across tissues to independent antibody HPA023374 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic positivity.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neuronal cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows weak to moderate cytoplasmic positivity in glandular cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows weak cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human small intestine shows weak to moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human ovary using Anti-PCM1 antibody HPA023370.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-PCM1 antibody HPA023370.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-PCM1 antibody HPA023370.
- Sample type
- HUMAN