Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [11]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA023374 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA023374, RRID:AB_1855073
- Product name
- Anti-PCM1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
TIYSEVATLISQNESRPHFLIELFHELQLLNTDYL
RQRALYALQDIVSRHISESHEKGENVKSVNSGTWI
ASNSELTPSESLATTDDETFEKNFE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references BBS mutations modify phenotypic expression of CEP290-related ciliopathies.
ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting.
Identification of cardiomyocyte nuclei and assessment of ploidy for the analysis of cell turnover
Zhang Y, Seo S, Bhattarai S, Bugge K, Searby CC, Zhang Q, Drack AV, Stone EM, Sheffield VC
Human molecular genetics 2014 Jan 1;23(1):40-51
Human molecular genetics 2014 Jan 1;23(1):40-51
ARL13B, PDE6D, and CEP164 form a functional network for INPP5E ciliary targeting.
Humbert MC, Weihbrecht K, Searby CC, Li Y, Pope RM, Sheffield VC, Seo S
Proceedings of the National Academy of Sciences of the United States of America 2012 Nov 27;109(48):19691-6
Proceedings of the National Academy of Sciences of the United States of America 2012 Nov 27;109(48):19691-6
Identification of cardiomyocyte nuclei and assessment of ploidy for the analysis of cell turnover
Bergmann O, Zdunek S, Alkass K, Druid H, Bernard S, Frisén J
Experimental Cell Research 2011 January;317(2):188-194
Experimental Cell Research 2011 January;317(2):188-194
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear membrane & centrosome.
- Sample type
- HUMAN
Enhanced validation
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human testis and liver tissues using HPA023374 antibody. Corresponding PCM1 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Independent antibody validation
- Main image
- Experimental details
- Immunohistochemical staining of human kidney, liver, ovary and testis using Anti-PCM1 antibody HPA023374 (A) shows similar protein distribution across tissues to independent antibody HPA023370 (B).
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows moderate to strong cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows strong cytoplasmic positivity in a subset of glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human ovary shows strong positivity in oocyte.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver shows weak positivity.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human ovary using Anti-PCM1 antibody HPA023374.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis using Anti-PCM1 antibody HPA023374.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human liver using Anti-PCM1 antibody HPA023374.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human kidney using Anti-PCM1 antibody HPA023374.
- Sample type
- HUMAN