HPA023374

PCM1 antibody from MilliporeSigma / Merck KGaA
PTC4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023374
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023374, RRID:AB_1855073
Product name
Anti-PCM1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023374
Antibody type
Polyclonal
Antigen
Pericentriolar material 1 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TIYSEVATLISQNESRPHFLIELFHELQLLNTDYL
RQRALYALQDIVSRHISESHEKGENVKSVNSGTWI
ASNSELTPSESLATTDDETFEKNFE
Storage
-20C
Provider Type Product Number
- No reagents -