HPA021506

NEU1 antibody from Sigma-Aldrich
NEU
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021506
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021506, RRID:AB_1854385
Product name
Anti-NEU1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021506
Antibody type
Polyclonal
Antigen
Sialidase-1 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQEND
FNPDECQPYELPDGSVVINARNQNNYHCHCRIVLR
SYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGI
VFFSNPAHPEFRVNLTLRWSFSNG
Storage
-20C
Provider Type Product Number
- No reagents -