HPA003334

MOSPD2 antibody from Sigma-Aldrich
MGC26706
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003334
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003334, RRID:AB_2146004
Product name
Anti-MOSPD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003334
Antibody type
Polyclonal
Antigen
Motile sperm domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SSKEDIESDGKETLETISNEEQTPLLKKINPTEST
SKAEENEKVDSKVKAFKKPLSVFKGPLLHISPAEE
LYFGSTESGEKKTLIVLTNVTKNIVAFKVRTTAPE
KYRVKPSNSSCDPGASVDIVVSPHGGLTVSA
Storage
-20C
Provider Type Product Number
- No reagents -