Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035721 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-CAPN14
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KVFHKQDRGSGYLNWEQLHAAMREAGIMLSDDVCQ
LMLIRYGGPRLQMDFVSFIHLMLRVENMEDVFQNL
TQDGKGIYLQKP- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Genetic, Inflammatory, and Epithelial Cell Differentiation Factors Control Expression of Human Calpain-14
Miller D, Forney C, Rochman M, Cranert S, Habel J, Rymer J, Lynch A, Schroeder C, Lee J, Sauder A, Smith Q, Chawla M, Trimarchi M, Lu X, Fjellman E, Brusilovsky M, Barski A, Waggoner S, Weirauch M, Rothenberg M, Kottyan L
G3 Genes|Genomes|Genetics 2019;9(3):729-736
G3 Genes|Genomes|Genetics 2019;9(3):729-736
No comments: Submit comment
No validations: Submit validation data