H00342184-M07
antibody from Abnova Corporation
Targeting: FMN1
DKFZP686C2281, FLJ45135, FMN, LD, MGC125288, MGC125289
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00342184-M07 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00342184-M07, RRID:AB_10712923
- Product name
- FMN1 monoclonal antibody (M07), clone 4F4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant FMN1.
- Antigen sequence
MENVDNSLDGSDVSEPAKPEAGLEVAQSILSKFSM
KSLFGFTSKLESVNPEEEDAVLKAFHSLDVNPTSQ
QDDSSNGLDPQEAGSRVSPDLGNDEKIASVETESE
GSQR- Isotype
- IgG
- Antibody clone number
- 4F4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FMN1 monoclonal antibody (M07), clone 4F4. Western Blot analysis of FMN1 expression in Jurkat.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- FMN1 monoclonal antibody (M07), clone 4F4. Western Blot analysis of FMN1 expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged FMN1 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to FMN1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol