Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- 45110002 - Provider product page

- Provider
- Novus Biologicals
- Proper citation
- Novus Cat#45110002, RRID:AB_10702185
- Product name
- Rabbit Polyclonal DPY30 Antibody
- Antibody type
- Polyclonal
- Antigen
- In vivo generated recombinant protein fragme
- Host
- Rabbit
- Antigen sequence
APAASAAAPAEAESNENTTVPSNVLSANGGQQTGN
QSAPRNTSTVPTRQYLDSTVVPILLQGLGALAKDR
PENPIEFLANFLLREKDRYNAENQNPAGQQ- Vial size
- 0.05 mg
- Storage
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Submitted references Physical and functional interaction between SET1/COMPASS complex component CFP-1 and a Sin3S HDAC complex in C. elegans.
Proteomic Analysis, Immune Dysregulation, and Pathway Interconnections with Obesity.
High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays.
Beurton F, Stempor P, Caron M, Appert A, Dong Y, Chen RA, Cluet D, Couté Y, Herbette M, Huang N, Polveche H, Spichty M, Bedet C, Ahringer J, Palladino F
Nucleic acids research 2019 Dec 2;47(21):11164-11180
Nucleic acids research 2019 Dec 2;47(21):11164-11180
Proteomic Analysis, Immune Dysregulation, and Pathway Interconnections with Obesity.
Garrison CB, Lastwika KJ, Zhang Y, Li CI, Lampe PD
Journal of proteome research 2017 Jan 6;16(1):274-287
Journal of proteome research 2017 Jan 6;16(1):274-287
High-throughput screening for native autoantigen-autoantibody complexes using antibody microarrays.
Rho JH, Lampe PD
Journal of proteome research 2013 May 3;12(5):2311-20
Journal of proteome research 2013 May 3;12(5):2311-20
No comments: Submit comment
No validations: Submit validation data