Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA040364 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-OTOGL
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
HMENGTSVVYAVGSTWHYNCTTYECVKTDEGAIIL
NYTMVCPPFNETECKMNEGIVKLYNEGCCKICKRE
ERICQKVIIKSV- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Mutations in OTOGL, encoding the inner ear protein otogelin-like, cause moderate sensorineural hearing loss.
Yariz KO, Duman D, Zazo Seco C, Dallman J, Huang M, Peters TA, Sirmaci A, Lu N, Schraders M, Skromne I, Oostrik J, Diaz-Horta O, Young JI, Tokgoz-Yilmaz S, Konukseven O, Shahin H, Hetterschijt L, Kanaan M, Oonk AM, Edwards YJ, Li H, Atalay S, Blanton S, Desmidt AA, Liu XZ, Pennings RJ, Lu Z, Chen ZY, Kremer H, Tekin M
American journal of human genetics 2012 Nov 2;91(5):872-82
American journal of human genetics 2012 Nov 2;91(5):872-82
No comments: Submit comment
No validations: Submit validation data