HPA003233

LRCH2 antibody from Sigma-Aldrich
KIAA1495
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003233
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003233, RRID:AB_2265929
Product name
Anti-LRCH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003233
Antibody type
Polyclonal
Antigen
Leucine-rich repeat and calponin homology domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GIGSDNGEKRLSTTEPSDDDTVSLHSQVSESNREQ
TSRNDSHIIGSKTDSQKDQEVYDFVDPNTEDVAVP
EQGNAHIGSFVSFFKGKEKCSEKSRKNEELGDEKR
LEKEQLLAEEEDDDLKEVTDLRKIAAQLLQQEQKN
RI
Storage
-20C
Provider Type Product Number
- No reagents -