Antibody data

Product number
PAB27472
Provider
Abnova Corporation
Product name
MAGEB17 polyclonal antibody
Provider product page
Abnova Corporation - PAB27472
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant MAGEB17.
Antigen sequence
LYLKEMDPSRQSYVLVGKLDFPNQGSLSDGGGFPL
SGLLMVLLSTIFMHGNRATEEEMWECLNALGMYKG
RKHFIYGEPQELVTKDLVREGYLEYQQVPSSDPPR
YEFLWGPRARAETSKMKV
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.