HPA003756

MAGEB17 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003756
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-MAGEB17 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA003756
Antibody type
Polyclonal
Antigen
Putative MAGE domain-containing protein ENSP00000382884 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LYLKEMDPSRQSYVLVGKLDFPNQGSLSDGGGFPL
SGLLMVLLSTIFMHGNRATEEEMWECLNALGMYKG
RKHFIYGEPQELVTKDLVREGYLEYQQVPSSDPPR
YEFLWGPRARAETSKMKV
Storage
-20C