HPA003756

MAGEB17 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003756
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003756, RRID:AB_2250114
Product name
Anti-MAGEB17 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003756
Antibody type
Polyclonal
Antigen
Putative MAGE domain-containing protein ENSP00000382884 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LYLKEMDPSRQSYVLVGKLDFPNQGSLSDGGGFPL
SGLLMVLLSTIFMHGNRATEEEMWECLNALGMYKG
RKHFIYGEPQELVTKDLVREGYLEYQQVPSSDPPR
YEFLWGPRARAETSKMKV
Storage
-20C
Provider Type Product Number
- No reagents -