Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA035598 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA035598, RRID:AB_10671108
- Product name
- Anti-MAP7D3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EADNEESDKDSLNEMFPSAILNGTGSPTKFKMPFN
NAKKMTHKLVFLEDGTSQVRKEPKTYFNGDLKNFR
QKSMKDTSIQEVVSRPSSKRMTSH- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Proteomic screen reveals Fbw7 as a modulator of the NF-κB pathway
Arabi A, Ullah K, Branca R, Johansson J, Bandarra D, Haneklaus M, Fu J, Ariës I, Nilsson P, Den Boer M, Pokrovskaja K, Grandér D, Xiao G, Rocha S, Lehtiö J, Sangfelt O
Nature Communications 2012 July;3
Nature Communications 2012 July;3
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN