HPA035324

ADGRG4 antibody from Atlas Antibodies
GPR112, PGR17, RP1-299I16

Antibody data

Product number
HPA035324
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035324, RRID:AB_10671512
Product name
Anti-ADGRG4
Provider product page
Atlas Antibodies - HPA035324
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
INTGKSQWEKPKFKQCKLLQELPDKIVDLANITIS
DENAEDVAEHILNLINESPALGKEETKIIVSKISD
ISQCDEISMNLTHVMLQIINVVLEKQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.