Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB27862 - Provider product page
- Provider
- Abnova Corporation
- Product name
- PIH1D2 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human PIH1D2.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
EGYEKFIQQQLKEGKQLCAAPEPQLCLQTRILKPK
EKILFINLCQWTRIPAPQSTTHPVPLTVGKPEDTT
EISDAYTVIDVAYNPDVLHAAEKDQVK- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).Lane 2: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY408526) with PIH1D2 polyclonal antibody (Cat # PAB27862) at 1:100-1:250 dilution.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with PIH1D2 polyclonal antibody (Cat # PAB27862) at 1-4 ug/mL dilution shows positivity in nucleus but not nucleoli & cytoplasm.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas with PIH1D2 polyclonal antibody (Cat # PAB27862) shows strong cytoplasmic and membranous positivity in exocrine glandular cells at 1:50-1:200 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
