HPA035557

HFM1 antibody from Atlas Antibodies
FLJ36760, FLJ39011, MER3, SEC63D1
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA035557
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA035557, RRID:AB_10696507
Product name
Anti-HFM1
Provider product page
Atlas Antibodies - HPA035557
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
FVGLDIQQKLTVFYLEPKRFGNQITMQRKSETQIS
HSKHSDISTIAGPNKGTTASKKPGNRECNHLCK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -