HPA003335

SMARCA1 antibody from Sigma-Aldrich
hSNF2L, ISWI, NURF140, SNF2L, SNF2L1, SNF2LB, SWI
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003335
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003335, RRID:AB_1080024
Product name
Anti-SMARCA1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003335
Antibody type
Polyclonal
Antigen
Probable global transcription activator SNF2L1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EQGSRVLIFSQMTRLLDILEDYCMWRGYEYCRLDG
QTPHEEREDKFLEVEFLGQREAIEAFNAPNSSKFI
FMLSTRAGGLGINLASADVVILYDSDWNPQVD
Storage
-20C
Provider Type Product Number
- No reagents -