Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB27500 - Provider product page

- Provider
- Abnova Corporation
- Product name
- FLJ44048 polyclonal antibody
- Antibody type
- Polyclonal
- Antigen
- Recombinant protein corresponding to amino acids of human FLJ44048.
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
SQMEPSSISILKENIVASEIIGTLMDQCTYFNESL
IQNLSRESLFQGAENAYTVNQVELATNMKMFTSKL
KEGSLGINPSQVSKTGFVFCSDEDMKEKY- Isotype
- IgG
- Vial size
- 100 μl
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescent staining of human cell line A-431 with FLJ44048 polyclonal antibody (Cat # PAB27500) at 1-4 ug/mL dilutions shows positivity in cytoskeleton (microtubules).
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunohistochemical staining of human duodenum with FLJ44048 polyclonal antibody (Cat # PAB27500) shows strong cytoplasmic positivity in glandular cells at 1:20-1:50 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)