HPA003336

DUSP9 antibody from Sigma-Aldrich
MKP-4, MKP4
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003336
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003336, RRID:AB_1078709
Product name
Anti-DUSP9 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003336
Antibody type
Polyclonal
Antigen
Dual specificity protein phosphatase 9 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ECPHLCETSLAGRAGSSMAPVPGPVPVVGLGSLCL
GSDCSDAESEADRDSMSCGLDSEGATPPPVGLRAS
FPVQILPNLYLGSARDSANLESLAKLGIRYILNVT
PNLPNFFEKNGDFHYKQI
Storage
-20C
Provider Type Product Number
- No reagents -