Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN785327 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 1, Methenyltetrahydrofolate Cyclohydrolase, Formyltetrahydrofolate Synthetase (MTHFD1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-MTHFD1 antibody: synthetic peptide directed towards the N terminal of human MTHFD1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENS
INTEE VINAIAPEKD- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The MTHFD1 gene is not involved in cleft lip with or without palate onset among the Italian population.
Palmieri A, Masiero E, Martinelli M, Scapoli L, Pezzetti F, Caramelli E, Guidotti L, Carinci F
Annals of human genetics 2008 May;72(Pt 3):297-9
Annals of human genetics 2008 May;72(Pt 3):297-9
No comments: Submit comment
No validations: Submit validation data