HPA015006

MTHFD1 antibody from Sigma-Aldrich
MTHFC, MTHFD
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015006
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015006, RRID:AB_1854178
Product name
Anti-MTHFD1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015006
Antibody type
Polyclonal
Antigen
C-1-tetrahydrofolate synthase, cytoplasmic recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AANNLVAAAIDARIFHELTQTDKALFNRLVPSVNG
VRRFSDIQIRRLKRLGIEKTDPTTLTDEEINRFAR
LDIDPETITWQRVLDTNDRFLRKITIGQAPTEKGH
TRTAQFDISVASEIMAVLALTTSLEDMRERLGKMV
VASSK
Storage
-20C
Provider Type Product Number
- No reagents -