HPA003314

RHOXF2 antibody from Sigma-Aldrich
CT107, PEPP-2, PEPP2, THG1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003314
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003314, RRID:AB_1855193
Product name
Anti-RHOXF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003314
Antibody type
Polyclonal
Antigen
Rhox homeobox family member 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DQCSQYMTSLLSPAVDDEKELQDMNAMVLSLTEEV
KEEEEDAQPEPEQGTAAGEKLKSAGAQGGEEKDGG
GEEKDGGGAGVPGHLWEGDLEGTSGSDGNVEDSDQ
SEKEPGQQ
Storage
-20C
Provider Type Product Number
- No reagents -