HPA026906

RETREG1 antibody from Sigma-Aldrich
FAM134B, FLJ20152, JK1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026906
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026906, RRID:AB_1848380
Product name
Anti-FAM134B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026906
Antibody type
Polyclonal
Antigen
Protein FAM134B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ENGMGTNDEDELSLGLPTELKRKKEQLDSGHRPSK
ETQSAAGLTLPLNSDQTFHLMSNLAGDVITAAVTA
AIKDQLEGVQQALSQAAPIPEEDTDTEEGDDFELL
DQSELDQIESELGLTQDQEAEAQQNKKSSG
Storage
-20C
Provider Type Product Number
- No reagents -